PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 155aa    MW: 18304.2 Da    PI: 9.3408
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25110.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.3e-1049106461
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  k+ +r + NR++A+rsR +K+++ e L++k keL+ e + ++ + e+l ++ ++lk 
  KFK25110.1  49 HKKLKRIILNRVSAQRSRWKKRQYAEYLAKKLKELQMEVSLMRARFEMLYEKTKRLKF 106
                 58999**********************************************9999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.1E-1143107No hitNo description
SMARTSM003383.1E-646110IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.63448111IPR004827Basic-leucine zipper domain
PfamPF077167.9E-94897IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-950105No hitNo description
CDDcd147036.28E-115197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MFRSCLPVPA SLQVSNGGNQ SEENKVDYFN YELEVDFNVG QDIDPNMDHK KLKRIILNRV  60
SAQRSRWKKR QYAEYLAKKL KELQMEVSLM RARFEMLYEK TKRLKFEHMK LQERVFATNQ  120
NFLGEGESEA FMMKLKKAGD EIGALELDIH MHLIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399196.14e-35hypothetical protein EUTSA_v10014931mg
TrEMBLA0A087G5F81e-112A0A087G5F8_ARAAL; Uncharacterized protein
STRINGBra009288.1-P5e-31(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.16e-26bZIP family protein